Producten (Fluorkunststof) slangenHogedrukslangenKrimpslangen, draad, kabel & vezelPTFE Glasweefsel banden&tapesCleanroom tubingEindproductenHalffabrikatenDigitale brochureD printing Materialen PTFEFEPPFAPVDFETFEECTFEMFATHVPCTFEPEEKVulstoffen in PTFE Industrien Lucht- en ruimtevaartAutomobiel in...
It has a alexa rank of #5,143,598 in the world. It is a domain having .nl extension. It is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently, polyfluor.nl is SAFE to browse.
Daily Unique Visitors: | 170 |
Daily Pageviews: | 340 |
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: |
![]() |
WOT Privacy: |
![]() |
WOT Child Safety: |
![]() |
Alexa Rank: | 5,143,598 |
PageSpeed Score: | 48 ON 100 |
Domain Authority: |
20 ON 100 ![]() |
Bounce Rate: | Not Applicable |
Time On Site: | Not Applicable |
Total Traffic: | No Data |
Direct Traffic: | No Data |
Referral Traffic: | No Data |
Search Traffic: | No Data |
Social Traffic: | No Data |
Mail Traffic: | No Data |
Display Traffic: | No Data |
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | 27 | H4 Headings: | 5 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 27 |
Google Adsense: | Not Applicable | Google Analytics: | UA-1700873-1 |
Words | Occurrences | Density | Possible Spam |
---|---|---|---|
Link naar | 12 | 1.573 % | No |
Meer informatie | 9 | 1.18 % | No |
FEP PFA | 5 | 0.655 % | No |
Constructie bouw | 5 | 0.655 % | No |
Lucht en | 5 | 0.655 % | No |
3D printing | 5 | 0.655 % | No |
PVDF ETFE | 5 | 0.655 % | No |
VerpakkingVoedings industrie | 5 | 0.655 % | No |
Medische industrie | 5 | 0.655 % | No |
Machine en | 5 | 0.655 % | No |
PFA PVDF | 4 | 0.524 % | No |
MFA THV | 4 | 0.524 % | No |
ECTFE MFA | 4 | 0.524 % | No |
ETFE ECTFE | 4 | 0.524 % | No |
in PTFE | 4 | 0.524 % | No |
bouw Defensie | 4 | 0.524 % | No |
Farmacie Medische | 4 | 0.524 % | No |
Polyfluor Plastics | 4 | 0.524 % | No |
Offshore OlieGasPetrochemie | 4 | 0.524 % | No |
Defensie Offshore | 4 | 0.524 % | No |
Words | Occurrences | Density | Possible Spam |
---|---|---|---|
PVDF ETFE ECTFE MFA | 4 | 0.524 % | No |
FEP PFA PVDF ETFE | 4 | 0.524 % | No |
PTFE FEP PFA PVDF | 4 | 0.524 % | No |
Krimpslangen draad kabel vezel | 4 | 0.524 % | No |
PFA PVDF ETFE ECTFE | 4 | 0.524 % | No |
Medische industrie Machine en | 4 | 0.524 % | No |
ETFE ECTFE MFA THV | 4 | 0.524 % | No |
Industrieën Lucht en ruimtevaart | 3 | 0.393 % | No |
en ruimtevaart Automobiel industrie | 3 | 0.393 % | No |
PTFE Industrieën Lucht en | 3 | 0.393 % | No |
Lucht en ruimtevaart Automobiel | 3 | 0.393 % | No |
PEEK Vulstoffen in PTFE | 3 | 0.393 % | No |
ruimtevaart Automobiel industrie Halfgeleider | 3 | 0.393 % | No |
Vulstoffen in PTFE Industrieën | 3 | 0.393 % | No |
in PTFE Industrieën Lucht | 3 | 0.393 % | No |
industrie Halfgeleider Constructie bouw | 3 | 0.393 % | No |
Farmacie Medische industrie Machine | 3 | 0.393 % | No |
Electronica Farmacie Medische industrie | 3 | 0.393 % | No |
industrie Machine en Apparatenbouw | 3 | 0.393 % | No |
Machine en Apparatenbouw VerpakkingVoedings | 3 | 0.393 % | No |
Host | IP Address | Country | |
---|---|---|---|
ns01.ips.nl | ![]() |
185.21.240.10 | ![]() |
ns02.ips.nl | ![]() |
185.21.242.150 | ![]() |
Host | Type | TTL | Extra |
---|---|---|---|
polyfluor.nl | A | 202 |
IP: 91.190.98.83 |
polyfluor.nl | NS | 300 |
Target: ns02.ips.nl |
polyfluor.nl | NS | 300 |
Target: ns01.ips.nl |
polyfluor.nl | SOA | 300 |
MNAME: ns01.ips.nl RNAME: hostmaster.ips.nl Serial: 2019040500 Refresh: 14400 Retry: 3600 Expire: 604800 |
polyfluor.nl | MX | 300 |
Priority: 10 Target: cluster03b.mx-relay.com |
polyfluor.nl | MX | 300 |
Priority: 10 Target: cluster03a.mx-relay.com |
polyfluor.nl | TXT | 300 |
TXT: v=spf1 mx include:_spf.ips.nl include:spf.protection.outlook.com include:_spf.afasonline.nl include:spf.afasonline.nl ip4:185.21.240.118 ip4:185.21.243.119 ip4:185.21.240.119 ip4:82.204.43.40 ip4:82.204.43.42 ip4:5.39.185.31 ip4:5.39.185.33 ip4:5.39.185.34 ip4:185.18.239.2 ip4:37.114.95.146 ip4:37.114.88.225 ip4:185.21.243.118 ip4:91.190.98.187 -all |
polyfluor.nl | TXT | 300 |
TXT: MS=ms13810390 |
TABELA INSS 2019 【ACESSE AQUI】 → Tabela de Contribuição INSS 2019 → Calendário INSS 2019 → Datas de Pagamento → Tabela Emprega Domestica. → Aposentaria → Dataprev → Extrato →...
El especialista en sillón relax. Desde 1964 fabricando sillones y butacas, sofás y auxiliares. Sillones reclinables. | Tapicerías Navarro | Tapicerías Navarro